PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_011618-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 251aa    MW: 29280.3 Da    PI: 4.7906
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_011618-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-183486456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     +++f++eq++ Le+ Fe++ ++  +++ + A++lgL+ rqV +WFqN+Ra++k
  AHYPO_011618-RA 34 KRRFSDEQVKSLESIFENETKLEPKKKVQVARELGLQPRQVAIWFQNKRARYK 86
                     568*************************************************9 PP

2HD-ZIP_I/II120.96.5e-3933124293
      HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      +krr+s+eqvk+LE+ Fe+e+kLep++Kv++areLglqprqva+WFqn+RAR+k+kqlEkdy++L+++y++l+++ ++L+ke+++L  +l++
  AHYPO_011618-RA  33 NKRRFSDEQVKSLESIFENETKLEPKKKVQVARELGLQPRQVAIWFQNKRARYKSKQLEKDYNTLRANYNSLAKRYDELNKEKQSLFVQLQK 124
                      69************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-171590IPR009057Homeodomain-like
PROSITE profilePS5007117.0062888IPR001356Homeobox domain
SMARTSM003891.9E-153192IPR001356Homeobox domain
PfamPF000461.5E-153486IPR001356Homeobox domain
CDDcd000869.70E-143489No hitNo description
Gene3DG3DSA:1.10.10.602.5E-183595IPR009057Homeodomain-like
PRINTSPR000313.0E-55968IPR000047Helix-turn-helix motif
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PRINTSPR000313.0E-56884IPR000047Helix-turn-helix motif
PfamPF021835.6E-1388128IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MMFDEGEYYS PSDVFSCINS IPNSRKIKMK MMNKRRFSDE QVKSLESIFE NETKLEPKKK  60
VQVARELGLQ PRQVAIWFQN KRARYKSKQL EKDYNTLRAN YNSLAKRYDE LNKEKQSLFV  120
QLQKLREQAE KEQGGASNEN ESDLSKEEIK SESENNNKTT KNEEKYEEKP ALSLEGSEYG  180
ACSILSDEGS SENTNYFTME DETDHILRMV QQPVDHHDSF TSGDQGWDDL HSPSLFDRPV  240
DSFQWCDFWS *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692437.11e-116PREDICTED: homeobox-leucine zipper protein ATHB-12
TrEMBLA0A0J8D7911e-99A0A0J8D791_BETVU; Uncharacterized protein
STRINGPOPTR_0014s09860.11e-66(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61890.18e-48homeobox 12